Lineage for d2cdpa_ (2cdp A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775408Species Saccharophagus degradans [TaxId:203122] [335921] (1 PDB entry)
  8. 2775409Domain d2cdpa_: 2cdp A: [335922]
    automated match to d4crra_
    complexed with ca, cl, edo

Details for d2cdpa_

PDB Entry: 2cdp (more details), 1.59 Å

PDB Description: structure of a cbm6 in complex with neoagarohexaose
PDB Compounds: (A:) beta-agarase 1

SCOPe Domain Sequences for d2cdpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdpa_ b.18.1.0 (A:) automated matches {Saccharophagus degradans [TaxId: 203122]}
stasiaveaenfnavggtfsdgqaqpvsvytvngntainyvnqgdyadytiavaqagnyt
isyqagsgvtggsieflvnengswasktvtavpnqgwdnfqplnggsvylsagthqvrlh
gagsnnwqwnldkftlsn

SCOPe Domain Coordinates for d2cdpa_:

Click to download the PDB-style file with coordinates for d2cdpa_.
(The format of our PDB-style files is described here.)

Timeline for d2cdpa_: