![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (51 species) not a true protein |
![]() | Species Saccharophagus degradans [TaxId:203122] [335921] (1 PDB entry) |
![]() | Domain d2cdpa_: 2cdp A: [335922] automated match to d4crra_ complexed with ca, cl, edo |
PDB Entry: 2cdp (more details), 1.59 Å
SCOPe Domain Sequences for d2cdpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cdpa_ b.18.1.0 (A:) automated matches {Saccharophagus degradans [TaxId: 203122]} stasiaveaenfnavggtfsdgqaqpvsvytvngntainyvnqgdyadytiavaqagnyt isyqagsgvtggsieflvnengswasktvtavpnqgwdnfqplnggsvylsagthqvrlh gagsnnwqwnldkftlsn
Timeline for d2cdpa_: