SCOP 1.69: Domain d1rtdc1: 1rtd C:430-554

Lineage for d1rtdc1 (1rtd C:430-554)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (80 PDB entries)

8. Domain d1rtdc1: 1rtd C:430-554 [33592]
   Other proteins in same PDB: d1rtda2, d1rtdb_, d1rtdc2, d1rtdd_

Details for d1rtdc1

PDB Entry: 1rtd, 3.2 Å

PDB Description: structure of a catalytic complex of hiv-1 reverse transcriptase: implications for nucleoside analog drug resistance

SCOP Domain Sequences for d1rtdc1:

Sequence; same for both SEQRES and ATOM records:

>d1rtdc1 c.55.3.1 (C:430-554) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltdttnqktqlqaiylalqds
glevnivtdsqyalgiiqaqpdeseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

Timeline for d1rtdc1:

• d1rtdc1 first appeared (with stable ids) in SCOP 1.55
  
• d1rtdc1 appears in SCOP 1.67
  
• d1rtdc1 appears in SCOP 1.71
  
• d1rtdc1 appears in the current release, SCOPe 2.08