Lineage for d1rtdc1 (1rtd C:430-554)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25212Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 25213Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 25218Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species)
  7. 25219Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (41 PDB entries)
  8. 25253Domain d1rtdc1: 1rtd C:430-554 [33592]
    Other proteins in same PDB: d1rtda2, d1rtdb1, d1rtdc2, d1rtdd1

Details for d1rtdc1

PDB Entry: 1rtd (more details), 3.2 Å

PDB Description: structure of a catalytic complex of hiv-1 reverse transcriptase: implications for nucleoside analog drug resistance

SCOP Domain Sequences for d1rtdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rtdc1 c.55.3.1 (C:430-554) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltdttnqktqlqaiylalqds
glevnivtdsqyalgiiqaqpdeseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

SCOP Domain Coordinates for d1rtdc1:

Click to download the PDB-style file with coordinates for d1rtdc1.
(The format of our PDB-style files is described here.)

Timeline for d1rtdc1: