Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) |
Family c.55.3.1: Ribonuclease H [53099] (3 proteins) |
Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (41 PDB entries) |
Domain d1rtdc1: 1rtd C:430-554 [33592] Other proteins in same PDB: d1rtda2, d1rtdb1, d1rtdc2, d1rtdd1 |
PDB Entry: 1rtd (more details), 3.2 Å
SCOP Domain Sequences for d1rtdc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rtdc1 c.55.3.1 (C:430-554) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1} ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltdttnqktqlqaiylalqds glevnivtdsqyalgiiqaqpdeseselvnqiieqlikkekvylawvpahkgiggneqvd klvsa
Timeline for d1rtdc1:
View in 3D Domains from other chains: (mouse over for more information) d1rtda1, d1rtda2, d1rtdb1, d1rtdd1 |