| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
| Domain d5t0yl2: 5t0y L:128-232 [335917] Other proteins in same PDB: d5t0ya_, d5t0yb1, d5t0yg1, d5t0yh_, d5t0yi_, d5t0yl1 automated match to d1p7kl2 complexed with so4 |
PDB Entry: 5t0y (more details), 3.01 Å
SCOPe Domain Sequences for d5t0yl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t0yl2 b.1.1.2 (L:128-232) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d5t0yl2: