![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
![]() | Domain d5x2nk2: 5x2n K:112-216 [335910] Other proteins in same PDB: d5x2na_, d5x2nb_, d5x2nc_, d5x2nd_, d5x2nh_, d5x2nj_, d5x2nk1, d5x2nl1 automated match to d1p7kl2 complexed with ala, cl, na, nag |
PDB Entry: 5x2n (more details), 2.2 Å
SCOPe Domain Sequences for d5x2nk2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x2nk2 b.1.1.2 (K:112-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d5x2nk2: