Lineage for d5x2pl2 (5x2p L:112-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752852Domain d5x2pl2: 5x2p L:112-217 [335902]
    Other proteins in same PDB: d5x2pa_, d5x2pb_, d5x2pc_, d5x2pd_, d5x2ph_, d5x2pj_, d5x2pk1, d5x2pl1
    automated match to d1p7kl2
    complexed with ca, cl, glu, na, nag

Details for d5x2pl2

PDB Entry: 5x2p (more details), 2.61 Å

PDB Description: crystal structure of the medaka fish taste receptor t1r2a-t1r3 ligand binding domains in complex with l-glutamate
PDB Compounds: (L:) Fab16A Light chain

SCOPe Domain Sequences for d5x2pl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x2pl2 b.1.1.2 (L:112-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d5x2pl2:

Click to download the PDB-style file with coordinates for d5x2pl2.
(The format of our PDB-style files is described here.)

Timeline for d5x2pl2: