| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d5x2pl1: 5x2p L:1-111 [335901] Other proteins in same PDB: d5x2pa_, d5x2pb_, d5x2pc_, d5x2pd_, d5x2ph_, d5x2pj_, d5x2pk2, d5x2pl2 automated match to d1kegl1 complexed with ca, cl, glu, na, nag |
PDB Entry: 5x2p (more details), 2.61 Å
SCOPe Domain Sequences for d5x2pl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x2pl1 b.1.1.0 (L:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratiscrasesvdsygnsfmhwyqqkpgqppillisrasnles
giparfsgsgsrtdftltinpveaddfatyycqqtnedprtfgggtkleik
Timeline for d5x2pl1: