| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88590] (69 PDB entries) Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region |
| Domain d5v43a2: 5v43 A:340-444 [335900] Other proteins in same PDB: d5v43a1, d5v43b1 automated match to d4dz8a2 |
PDB Entry: 5v43 (more details), 2.32 Å
SCOPe Domain Sequences for d5v43a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v43a2 b.1.1.2 (A:340-444) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngrpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls
Timeline for d5v43a2: