Lineage for d1rdhb1 (1rdh B:432-556)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2123752Family c.55.3.1: Ribonuclease H [53099] (5 protein domains)
  6. 2123803Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)
  7. 2123813Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (104 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 2123890Domain d1rdhb1: 1rdh B:432-556 [33589]
    CA-atoms only

Details for d1rdhb1

PDB Entry: 1rdh (more details), 2.8 Å

PDB Description: crystallographic analyses of an active hiv-1 ribonuclease h domain show structural features that distinguish it from the inactive form
PDB Compounds: (B:) hiv-1 reverse transcriptase (ribonuclease h domain)

SCOPe Domain Sequences for d1rdhb1:

Sequence, based on SEQRES records: (download)

>d1rdhb1 c.55.3.1 (B:432-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
epivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqdsgl
evnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvdkl
vsagi

Sequence, based on observed residues (ATOM records): (download)

>d1rdhb1 c.55.3.1 (B:432-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
epivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqdsgl
evnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpaiggneqvdklvsa
gi

SCOPe Domain Coordinates for d1rdhb1:

Click to download the PDB-style file with coordinates for d1rdhb1.
(The format of our PDB-style files is described here.)

Timeline for d1rdhb1: