Lineage for d1rdha1 (1rdh A:432-556)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) 
Family c.55.3.1: Ribonuclease H [53099] (3 proteins) 
Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species) Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (41 PDB entries) 
Domain d1rdha1: 1rdh A:432-556 [33588]
Details for d1rdha1
PDB Entry: 1rdh (more details), 2.8 Å
PDB Description: crystallographic analyses of an active hiv-1 ribonuclease h domain show structural features that distinguish it from the inactive form
SCOP Domain Sequences for d1rdha1:
Sequence, based on SEQRES records: (download)
>d1rdha1 c.55.3.1 (A:432-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
epivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqdsgl
evnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvdkl
vsagi
Sequence, based on observed residues (ATOM records): (download)
>d1rdha1 c.55.3.1 (A:432-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
epivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqdsgl
evnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpaiggneqvdklvsa
gi
SCOP Domain Coordinates for d1rdha1:
Click to download the PDB-style file with coordinates for d1rdha1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rdha1:
- d1rdha1 appears in SCOP 1.57
- d1rdha1 appears in the current release, SCOPe 2.08
View in 3D
