Lineage for d5ldab_ (5lda B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540821Superfamily d.15.3: MoaD/ThiS [54285] (5 families) (S)
    possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies
  5. 2540840Family d.15.3.2: ThiS [54289] (5 proteins)
  6. 2540844Protein Hypothetical protein PF1061 [102796] (1 species)
  7. 2540845Species Pyrococcus furiosus [TaxId:2261] [102797] (3 PDB entries)
  8. 2540846Domain d5ldab_: 5lda B: [335874]
    automated match to d1rwsa_
    complexed with gol, zn

Details for d5ldab_

PDB Entry: 5lda (more details), 1.9 Å

PDB Description: structure of deubiquitinating enzyme homolog (pyrococcus furiosus jamm1) in complex with ubiquitin-like samp2.
PDB Compounds: (B:) samp2

SCOPe Domain Sequences for d5ldab_:

Sequence, based on SEQRES records: (download)

>d5ldab_ d.15.3.2 (B:) Hypothetical protein PF1061 {Pyrococcus furiosus [TaxId: 2261]}
kvkvigrniekeiewregmkvrdilravgfntesaiakvngkvvleddevkdgdfvevip
vvsgg

Sequence, based on observed residues (ATOM records): (download)

>d5ldab_ d.15.3.2 (B:) Hypothetical protein PF1061 {Pyrococcus furiosus [TaxId: 2261]}
kvkvigrniemkvrdilravgfntesaiakvngkvvleddevkdgdfvevipvvsgg

SCOPe Domain Coordinates for d5ldab_:

Click to download the PDB-style file with coordinates for d5ldab_.
(The format of our PDB-style files is described here.)

Timeline for d5ldab_: