Lineage for d5x2ol1 (5x2o L:1-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760456Domain d5x2ol1: 5x2o L:1-111 [335868]
    Other proteins in same PDB: d5x2oa_, d5x2ob_, d5x2oc_, d5x2od_, d5x2oh_, d5x2oj_, d5x2ok2, d5x2ol2
    automated match to d1kegl1
    complexed with arg, ca, cl, na, nag

Details for d5x2ol1

PDB Entry: 5x2o (more details), 2.6 Å

PDB Description: crystal structure of the medaka fish taste receptor t1r2a-t1r3 ligand binding domains in complex with l-arginine
PDB Compounds: (L:) Fab16A Light chain

SCOPe Domain Sequences for d5x2ol1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x2ol1 b.1.1.0 (L:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratiscrasesvdsygnsfmhwyqqkpgqppillisrasnles
giparfsgsgsrtdftltinpveaddfatyycqqtnedprtfgggtkleik

SCOPe Domain Coordinates for d5x2ol1:

Click to download the PDB-style file with coordinates for d5x2ol1.
(The format of our PDB-style files is described here.)

Timeline for d5x2ol1: