![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
![]() | Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
![]() | Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
![]() | Protein automated matches [196409] (46 species) not a true protein |
![]() | Species Oryza sativa [TaxId:39947] [335863] (1 PDB entry) |
![]() | Domain d5xn5b_: 5xn5 B: [335867] automated match to d5e8hb_ |
PDB Entry: 5xn5 (more details), 2 Å
SCOPe Domain Sequences for d5xn5b_:
Sequence, based on SEQRES records: (download)
>d5xn5b_ a.128.1.0 (B:) automated matches {Oryza sativa [TaxId: 39947]} fdfnaymgekaaavnraldasipadeppaalheamryallaggkrvrpalclaacavvgg reawampaaaavemvhtmslvhddlpcmddddlrrgkptchvvygepiavltgdallsls fhhmarfdsyppdidadkhparvvraigelarcigseglvagqvvdlemtgstetvpler leyihlhktaalleasvvigailgggsdeqieslrmyarsigllfqvvddildvtkssee lgktagkdlasdkttypkllgleksrefaekllsdareqlsgfdqetaapllhlanyiay rqn
>d5xn5b_ a.128.1.0 (B:) automated matches {Oryza sativa [TaxId: 39947]} fdfnaymgekaaavnraldasipadeppaalheamryallaggkrvrpalclaacavvgg reawampaaaavemvhtmslvhddlpcmddddlrrgkptchvvygepiavltgdallsls fhhmarfdsyppdidadkhparvvraigelarcigseglvagqvvdlemtvplerleyih lhktaalleasvvigailgggsdeqieslrmyarsigllfqvvddildvtkttypkllgl eksrefaekllsdareqlsgfdqetaapllhlanyiayrqn
Timeline for d5xn5b_: