Lineage for d1hnia1 (1hni A:430-558)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25212Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 25213Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 25218Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species)
  7. 25219Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (41 PDB entries)
  8. 25246Domain d1hnia1: 1hni A:430-558 [33586]
    Other proteins in same PDB: d1hnia2, d1hnib1

Details for d1hnia1

PDB Entry: 1hni (more details), 2.8 Å

PDB Description: structure of hiv-1 reverse transcriptase in a complex with the nonnucleoside inhibitor alpha-apa r 95845 at 2.8 angstroms resolution

SCOP Domain Sequences for d1hnia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnia1 c.55.3.1 (A:430-558) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagirk

SCOP Domain Coordinates for d1hnia1:

Click to download the PDB-style file with coordinates for d1hnia1.
(The format of our PDB-style files is described here.)

Timeline for d1hnia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hnia2
View in 3D
Domains from other chains:
(mouse over for more information)
d1hnib1