Lineage for d5up7a_ (5up7 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2700840Protein (Apo)ferritin [47246] (8 species)
  7. 2701140Species Human (Homo sapiens), H chain [TaxId:9606] [47247] (46 PDB entries)
  8. 2701264Domain d5up7a_: 5up7 A: [335858]
    automated match to d4ml5a_
    complexed with ca, cl, edo, ni

Details for d5up7a_

PDB Entry: 5up7 (more details), 1.79 Å

PDB Description: crystal structure of the ni-bound human heavy-chain ferritin 122h- delta c-star variant
PDB Compounds: (A:) ferritin heavy chain

SCOPe Domain Sequences for d5up7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5up7a_ a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens), H chain [TaxId: 9606]}
tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhklahdk
ndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

SCOPe Domain Coordinates for d5up7a_:

Click to download the PDB-style file with coordinates for d5up7a_.
(The format of our PDB-style files is described here.)

Timeline for d5up7a_: