SCOPe 2.08: Domain d5v7je1: 5v7j E:2-111

Lineage for d5v7je1 (5v7j E:2-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5v7je1: 5v7j E:2-111 [335853]
   Other proteins in same PDB: d5v7je2, d5v7jh2, d5v7jl2
   automated match to d2mcg11
   complexed with nag

Details for d5v7je1

PDB Entry: 5v7j, 2.91 Å

PDB Description: crystal structure at 3.7 a resolution of glycosylated hiv-1 clade a bg505 sosip.664 prefusion env trimer with four glycans (n197, n276, n362, and n462) removed in complex with neutralizing antibodies 3h+109l and 35o22.

PDB Compounds: (E:) Antibody 35O22 Fab heavy chain

SCOPe Domain Sequences for d5v7je1:

Sequence; same for both SEQRES and ATOM records:

>d5v7je1 b.1.1.0 (E:2-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqsasvsgslgqsvtisctgpnsvccshksiswyqwppgraptliiyednerapgis
prfsgyksywsayltisdlrpedettyyccsythnsgcvfgtgtkvsvlg

Timeline for d5v7je1:

• d5v7je1 first appeared in SCOPe 2.06
  
• d5v7je1 appears in SCOPe 2.07