Lineage for d5usrk_ (5usr K:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706248Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 2706249Protein automated matches [191038] (29 species)
    not a true protein
  7. 2706273Species Escherichia coli [TaxId:83333] [335816] (1 PDB entry)
  8. 2706276Domain d5usrk_: 5usr K: [335851]
    Other proteins in same PDB: d5usra1, d5usra2, d5usrb_, d5usrc_, d5usrd_, d5usre1, d5usre2, d5usrf_, d5usrg1, d5usrg2, d5usrh_
    automated match to d2n57a_
    complexed with 8q1

Details for d5usrk_

PDB Entry: 5usr (more details), 3.09 Å

PDB Description: crystal structure of human nfs1-isd11 in complex with e. coli acyl- carrier protein at 3.09 angstroms
PDB Compounds: (K:) Acyl carrier protein

SCOPe Domain Sequences for d5usrk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5usrk_ a.28.1.0 (K:) automated matches {Escherichia coli [TaxId: 83333]}
eervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeaekit
tvqaaidyi

SCOPe Domain Coordinates for d5usrk_:

Click to download the PDB-style file with coordinates for d5usrk_.
(The format of our PDB-style files is described here.)

Timeline for d5usrk_: