SCOP 1.65: Domain d1rtia1: 1rti A:430-543

Lineage for d1rtia1 (1rti A:430-543)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (65 PDB entries)

8. Domain d1rtia1: 1rti A:430-543 [33585]
   Other proteins in same PDB: d1rtia2, d1rtib1
   complexed with cya, hef

Details for d1rtia1

PDB Entry: 1rti, 3 Å

PDB Description: high resolution structures of hiv-1 rt from four rt-inhibitor complexes

SCOP Domain Sequences for d1rtia1:

Sequence; same for both SEQRES and ATOM records:

>d1rtia1 c.55.3.1 (A:430-543) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgig

Timeline for d1rtia1:

• d1rtia1 first appeared (with stable ids) in SCOP 1.55
  
• d1rtia1 appears in SCOP 1.63
  
• d1rtia1 appears in SCOP 1.67
  
• d1rtia1 appears in the current release, SCOPe 2.08