Lineage for d5v8zc1 (5v8z C:158-254)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330885Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
    5 helices; bundle
  4. 2330886Superfamily a.71.1: ERP29 C domain-like [47933] (2 families) (S)
    automatically mapped to Pfam PF07749
  5. 2330887Family a.71.1.1: ERP29 C domain-like [47934] (3 proteins)
  6. 2330896Protein automated matches [335837] (1 species)
    not a true protein
  7. 2330897Species Human (Homo sapiens) [TaxId:9606] [335838] (1 PDB entry)
  8. 2330899Domain d5v8zc1: 5v8z C:158-254 [335839]
    Other proteins in same PDB: d5v8za2, d5v8zc2
    automated match to d1g7da_

Details for d5v8zc1

PDB Entry: 5v8z (more details), 2.11 Å

PDB Description: crystal structure of erp29 d-domain in complex with the p-domain of calmegin
PDB Compounds: (C:) Endoplasmic reticulum resident protein 29

SCOPe Domain Sequences for d5v8zc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v8zc1 a.71.1.1 (C:158-254) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpvydalagefirasgvearqallkqgqdnlssvketqkkwaeqylkimgkildqgedfp
asemtriarlieknkmsdgkkeelqkslniltafqkk

SCOPe Domain Coordinates for d5v8zc1:

Click to download the PDB-style file with coordinates for d5v8zc1.
(The format of our PDB-style files is described here.)

Timeline for d5v8zc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5v8zc2