![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.71: ERP29 C domain-like [47932] (2 superfamilies) 5 helices; bundle |
![]() | Superfamily a.71.1: ERP29 C domain-like [47933] (2 families) ![]() automatically mapped to Pfam PF07749 |
![]() | Family a.71.1.1: ERP29 C domain-like [47934] (3 proteins) |
![]() | Protein automated matches [335837] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [335838] (1 PDB entry) |
![]() | Domain d5v8zc1: 5v8z C:158-254 [335839] Other proteins in same PDB: d5v8za2, d5v8zc2 automated match to d1g7da_ |
PDB Entry: 5v8z (more details), 2.11 Å
SCOPe Domain Sequences for d5v8zc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v8zc1 a.71.1.1 (C:158-254) automated matches {Human (Homo sapiens) [TaxId: 9606]} lpvydalagefirasgvearqallkqgqdnlssvketqkkwaeqylkimgkildqgedfp asemtriarlieknkmsdgkkeelqkslniltafqkk
Timeline for d5v8zc1: