![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
![]() | Protein automated matches [190036] (60 species) not a true protein |
![]() | Species Rhodospirillum rubrum [TaxId:269796] [335612] (2 PDB entries) |
![]() | Domain d5l8fj_: 5l8f J: [335825] Other proteins in same PDB: d5l8fb2, d5l8fg2, d5l8fi2 automated match to d1zpyg_ complexed with mg, pge; mutant |
PDB Entry: 5l8f (more details), 2.25 Å
SCOPe Domain Sequences for d5l8fj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l8fj_ a.25.1.0 (J:) automated matches {Rhodospirillum rubrum [TaxId: 269796]} stheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrdeakeaa amtlewlrrndakwaehlrtylftegpita
Timeline for d5l8fj_: