Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) |
Family c.55.3.1: Ribonuclease H [53099] (3 proteins) |
Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (41 PDB entries) |
Domain d1reva1: 1rev A:430-539 [33582] Other proteins in same PDB: d1reva2, d1revb1 |
PDB Entry: 1rev (more details), 2.6 Å
SCOP Domain Sequences for d1reva1:
Sequence, based on SEQRES records: (download)
>d1reva1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1} ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah
>d1reva1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1} ekepivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglevnivtdsq yalgiiqaqpdqseselvnqiieqlikkekvylawvpah
Timeline for d1reva1: