| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
| Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
| Protein automated matches [191038] (29 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [335816] (1 PDB entry) |
| Domain d5usri_: 5usr I: [335817] Other proteins in same PDB: d5usra1, d5usra2, d5usrb_, d5usrc_, d5usrd_, d5usre1, d5usre2, d5usrf_, d5usrg1, d5usrg2, d5usrh_ automated match to d2n57a_ complexed with 8q1 |
PDB Entry: 5usr (more details), 3.09 Å
SCOPe Domain Sequences for d5usri_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5usri_ a.28.1.0 (I:) automated matches {Escherichia coli [TaxId: 83333]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyinghq
Timeline for d5usri_: