SCOP 1.71: Domain d1rtja1: 1rtj A:430-543

Lineage for d1rtja1 (1rtj A:430-543)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (85 PDB entries)

8. Domain d1rtja1: 1rtj A:430-543 [33581]
   Other proteins in same PDB: d1rtja2, d1rtjb1
   complexed with cya

Details for d1rtja1

PDB Entry: 1rtj, 2.35 Å

PDB Description: mechanism of inhibition of hiv-1 reverse transcriptase by non-nucleoside inhibitors

PDB Compounds: (A:)

SCOP Domain Sequences for d1rtja1:

Sequence; same for both SEQRES and ATOM records:

>d1rtja1 c.55.3.1 (A:430-543) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgig

Timeline for d1rtja1:

• d1rtja1 first appeared (with stable ids) in SCOP 1.55
  
• d1rtja1 appears in SCOP 1.69
  
• d1rtja1 appears in SCOP 1.73
  
• d1rtja1 appears in the current release, SCOPe 2.07