SCOPe 2.08: Domain d5t0yb1: 5t0y B:1-127

Lineage for d5t0yb1 (5t0y B:1-127)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5t0yb1: 5t0y B:1-127 [335792]
   Other proteins in same PDB: d5t0ya_, d5t0yb2, d5t0yg2, d5t0yh_, d5t0yi_, d5t0yl2
   automated match to d1kegl1
   complexed with so4

Details for d5t0yb1

PDB Entry: 5t0y, 3.01 Å

PDB Description: 2a10 antibody fab fragment

PDB Compounds: (B:) 2A10 FAB fragment light chain

SCOPe Domain Sequences for d5t0yb1:

Sequence; same for both SEQRES and ATOM records:

>d5t0yb1 b.1.1.0 (B:1-127) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscsasqgisnylnwyqqkpdgtvkllifytstlysgvps
rfsgsgsgtdysltisnlepediatyycqqysrfpyvfgggtkleik

Timeline for d5t0yb1:

• d5t0yb1 first appeared in SCOPe 2.06
  
• d5t0yb1 appears in SCOPe 2.07