| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) ![]() |
| Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
| Protein automated matches [191156] (10 species) not a true protein |
| Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (8 PDB entries) |
| Domain d5o2ua_: 5o2u A: [335771] Other proteins in same PDB: d5o2ub_, d5o2ud_ automated match to d2koda_ |
PDB Entry: 5o2u (more details), 2.76 Å
SCOPe Domain Sequences for d5o2ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o2ua_ a.28.3.0 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
sildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpg
atleemmtacqgv
Timeline for d5o2ua_: