SCOPe 2.07: Domain d1hrha1: 1hrh A:432-556

Lineage for d1hrha1 (1hrh A:432-556)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (104 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d1hrha1: 1hrh A:432-556 [33577]

Details for d1hrha1

PDB Entry: 1hrh, 2.4 Å

PDB Description: crystal structure of the ribonuclease h domain of hiv-1 reverse transcriptase

PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d1hrha1:

Sequence, based on SEQRES records:

>d1hrha1 c.55.3.1 (A:432-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
epivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqdsgl
evnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvdkl
vsagi

Sequence, based on observed residues (ATOM records):

>d1hrha1 c.55.3.1 (A:432-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
epivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqdsgl
evnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpggneqvdklvsagi

Timeline for d1hrha1:

• d1hrha1 first appeared (with stable ids) in SCOP 1.55
  
• d1hrha1 appears in SCOPe 2.06
  
• d1hrha1 appears in the current release, SCOPe 2.08