Lineage for d1hrha1 (1hrh A:432-556)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25212Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 25213Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 25218Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species)
  7. 25219Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (41 PDB entries)
  8. 25224Domain d1hrha1: 1hrh A:432-556 [33577]

Details for d1hrha1

PDB Entry: 1hrh (more details), 2.4 Å

PDB Description: crystal structure of the ribonuclease h domain of hiv-1 reverse transcriptase

SCOP Domain Sequences for d1hrha1:

Sequence, based on SEQRES records: (download)

>d1hrha1 c.55.3.1 (A:432-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
epivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqdsgl
evnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvdkl
vsagi

Sequence, based on observed residues (ATOM records): (download)

>d1hrha1 c.55.3.1 (A:432-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
epivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqdsgl
evnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpggneqvdklvsagi

SCOP Domain Coordinates for d1hrha1:

Click to download the PDB-style file with coordinates for d1hrha1.
(The format of our PDB-style files is described here.)

Timeline for d1hrha1: