Lineage for d5gmae1 (5gma E:1-323)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509052Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins)
    Pfam PF05448; AXE1
  6. 2509053Protein Acetyl xylan esterase TM0077 [110693] (1 species)
  7. 2509054Species Thermotoga maritima [TaxId:2336] [110694] (5 PDB entries)
    Uniprot Q9WXT2
  8. 2509071Domain d5gmae1: 5gma E:1-323 [335760]
    Other proteins in same PDB: d5gmaa2, d5gmab2, d5gmac2, d5gmad2, d5gmae2, d5gmaf2
    automated match to d1l7aa_
    complexed with act

Details for d5gmae1

PDB Entry: 5gma (more details), 2.1 Å

PDB Description: crystal structure of the p228a variant of thermotoga maritima acetyl esterase
PDB Compounds: (E:) Cephalosporin-C deacetylase

SCOPe Domain Sequences for d5gmae1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gmae1 c.69.1.25 (E:1-323) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]}
maffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvt
fsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgq
gsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqe
riviaggsqgggialavsalskkakallcdvpflchfrravqlvdthayaeitnflkthr
dkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypy
nnhegggsfqaveqvkflkklfe

SCOPe Domain Coordinates for d5gmae1:

Click to download the PDB-style file with coordinates for d5gmae1.
(The format of our PDB-style files is described here.)

Timeline for d5gmae1: