![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins) Pfam PF05448; AXE1 |
![]() | Protein Acetyl xylan esterase TM0077 [110693] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [110694] (5 PDB entries) Uniprot Q9WXT2 |
![]() | Domain d5gmae1: 5gma E:1-323 [335760] Other proteins in same PDB: d5gmaa2, d5gmab2, d5gmac2, d5gmad2, d5gmae2, d5gmaf2 automated match to d1l7aa_ complexed with act |
PDB Entry: 5gma (more details), 2.1 Å
SCOPe Domain Sequences for d5gmae1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gmae1 c.69.1.25 (E:1-323) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} maffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvt fsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgq gsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqe riviaggsqgggialavsalskkakallcdvpflchfrravqlvdthayaeitnflkthr dkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypy nnhegggsfqaveqvkflkklfe
Timeline for d5gmae1: