Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Coagulation factor VIIa [50550] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50551] (90 PDB entries) Uniprot P08709 213-466 ! Uniprot P08709 213-446 |
Domain d5parc_: 5par C: [335754] Other proteins in same PDB: d5para_ automated match to d1klih_ complexed with ax7, ca, cl, gol, so4 |
PDB Entry: 5par (more details), 2.1 Å
SCOPe Domain Sequences for d5parc_:
Sequence, based on SEQRES records: (download)
>d5parc_ b.47.1.2 (C:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrkvgdspniteymfcagy sdgskdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmr seprpgvllrapfp
>d5parc_ b.47.1.2 (C:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrspniteymfcagysdgs kdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmrsepr pgvllrapfp
Timeline for d5parc_: