Lineage for d5pa8a_ (5pa8 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031147Protein Coagulation factor VIIa [57201] (1 species)
  7. 3031148Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 3031214Domain d5pa8a_: 5pa8 A: [335751]
    Other proteins in same PDB: d5pa8c_
    automated match to d1klil_
    complexed with ca, cl, gol, hai, so4

Details for d5pa8a_

PDB Entry: 5pa8 (more details), 1.98 Å

PDB Description: crystal structure of factor viia in complex with cyclohexanamine
PDB Compounds: (A:) Coagulation factor VII light chain

SCOPe Domain Sequences for d5pa8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5pa8a_ g.3.11.1 (A:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
licvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekrna

SCOPe Domain Coordinates for d5pa8a_:

Click to download the PDB-style file with coordinates for d5pa8a_.
(The format of our PDB-style files is described here.)

Timeline for d5pa8a_:

3031214
d5pa8a_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d5pa8c_