Lineage for d5gmaf1 (5gma F:1-323)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152338Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins)
    Pfam PF05448; AXE1
  6. 2152379Protein automated matches [191114] (3 species)
    not a true protein
  7. 2152466Species Thermotoga maritima [TaxId:243274] [317746] (2 PDB entries)
  8. 2152472Domain d5gmaf1: 5gma F:1-323 [335748]
    Other proteins in same PDB: d5gmaa2, d5gmab2, d5gmac2, d5gmad2, d5gmae2, d5gmaf2
    automated match to d1l7aa_
    complexed with act

Details for d5gmaf1

PDB Entry: 5gma (more details), 2.1 Å

PDB Description: crystal structure of the p228a variant of thermotoga maritima acetyl esterase
PDB Compounds: (F:) Cephalosporin-C deacetylase

SCOPe Domain Sequences for d5gmaf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gmaf1 c.69.1.25 (F:1-323) automated matches {Thermotoga maritima [TaxId: 243274]}
maffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvt
fsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgq
gsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqe
riviaggsqgggialavsalskkakallcdvpflchfrravqlvdthayaeitnflkthr
dkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypy
nnhegggsfqaveqvkflkklfe

SCOPe Domain Coordinates for d5gmaf1:

Click to download the PDB-style file with coordinates for d5gmaf1.
(The format of our PDB-style files is described here.)

Timeline for d5gmaf1: