| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries) |
| Domain d5m30f1: 5m30 F:1-118 [335744] Other proteins in same PDB: d5m30d2, d5m30e2, d5m30f2 automated match to d4ldeb_ |
PDB Entry: 5m30 (more details), 2.6 Å
SCOPe Domain Sequences for d5m30f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m30f1 b.1.1.1 (F:1-118) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvesggglvqaggtlklscaasgsisgivvmawyrqapgkqrelvasitsggttnya
dsvkgrftiskdnaentlylrmnslkpedtavyyckaffrrdyvgydywgqgtqvtvs
Timeline for d5m30f1:
View in 3DDomains from other chains: (mouse over for more information) d5m30d1, d5m30d2, d5m30e1, d5m30e2 |