SCOPe 2.08: Domain d5m30f1: 5m30 F:1-118

Lineage for d5m30f1 (5m30 F:1-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d5m30f1: 5m30 F:1-118 [335744]
   Other proteins in same PDB: d5m30d2, d5m30e2, d5m30f2
   automated match to d4ldeb_

Details for d5m30f1

PDB Entry: 5m30, 2.6 Å

PDB Description: structure of tssk from t6ss eaec in complex with nanobody nb18

PDB Compounds: (F:) Anti-vesicular stomatitis virus N VHH

SCOPe Domain Sequences for d5m30f1:

Sequence; same for both SEQRES and ATOM records:

>d5m30f1 b.1.1.1 (F:1-118) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvesggglvqaggtlklscaasgsisgivvmawyrqapgkqrelvasitsggttnya
dsvkgrftiskdnaentlylrmnslkpedtavyyckaffrrdyvgydywgqgtqvtvs

Timeline for d5m30f1:

• d5m30f1 first appeared in SCOPe 2.06
  
• d5m30f1 appears in SCOPe 2.07