Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.15: Integrin domains [69179] (2 families) |
Family b.1.15.0: automated matches [233856] (1 protein) not a true family |
Protein automated matches [233857] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [233858] (16 PDB entries) |
Domain d5neta2: 5net A:439-594 [335742] Other proteins in same PDB: d5net1_, d5net3_, d5neta1 automated match to d1m1xa1 complexed with ca, man, nag |
PDB Entry: 5net (more details), 8.6 Å
SCOPe Domain Sequences for d5neta2:
Sequence, based on SEQRES records: (download)
>d5neta2 b.1.15.0 (A:439-594) automated matches {Human (Homo sapiens) [TaxId: 9606]} pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell ldklkqkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitif meyrldyrtaadttglqpilnqftpanisrqahill
>d5neta2 b.1.15.0 (A:439-594) automated matches {Human (Homo sapiens) [TaxId: 9606]} pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell ldklkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitifme yrldyrtaadttglqpilnqftpanisrqahill
Timeline for d5neta2: