Lineage for d5neta1 (5net A:1-438)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399102Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2399674Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 2399675Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 protein domains)
  6. 2399717Protein automated matches [254690] (1 species)
    not a true protein
  7. 2399718Species Human (Homo sapiens) [TaxId:9606] [255892] (11 PDB entries)
  8. 2399728Domain d5neta1: 5net A:1-438 [335741]
    Other proteins in same PDB: d5net1_, d5net3_, d5neta2
    automated match to d1m1xa4
    complexed with ca, man, nag

Details for d5neta1

PDB Entry: 5net (more details), 8.6 Å

PDB Description: localised reconstruction of integrin alpha v beta 6 bound to foot and mouth disease virus o1 manisa - pose a.
PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d5neta1:

Sequence, based on SEQRES records: (download)

>d5neta1 b.69.8.1 (A:1-438) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
aapyggedkkgivyifngrstglnavpsqilegqwaarscppsfgysmkgatdidkngyp
dlivgafgvdrailyrar

Sequence, based on observed residues (ATOM records): (download)

>d5neta1 b.69.8.1 (A:1-438) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnldvdspaeysgpegsyfgfavdffvpssrmfllvgapkanttqpgiveggqvlkcdws
strrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkqer
epvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywqgq
lisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfvsg
vpraartlgmvyiydgknmssynftgeqmaayfgfsvaatdingddyadvfigaplfmdr
gsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiaiaap
yggedkkgivyifngrstglnavpsqilegqwaarscppsfgysmkgatdidkngypdli
vgafgvdrailyrar

SCOPe Domain Coordinates for d5neta1:

Click to download the PDB-style file with coordinates for d5neta1.
(The format of our PDB-style files is described here.)

Timeline for d5neta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5neta2