Lineage for d5neua2 (5neu A:439-594)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764933Superfamily b.1.15: Integrin domains [69179] (2 families) (S)
  5. 2764962Family b.1.15.0: automated matches [233856] (1 protein)
    not a true family
  6. 2764963Protein automated matches [233857] (1 species)
    not a true protein
  7. 2764964Species Human (Homo sapiens) [TaxId:9606] [233858] (16 PDB entries)
  8. 2764998Domain d5neua2: 5neu A:439-594 [335740]
    Other proteins in same PDB: d5neu1_, d5neu3_, d5neua1
    automated match to d1m1xa1
    complexed with ca, mg

Details for d5neua2

PDB Entry: 5neu (more details), 12.3 Å

PDB Description: localised reconstruction of integrin alpha v beta 6 bound to foot and mouth disease virus o1 manisa - pose b.
PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d5neua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5neua2 b.1.15.0 (A:439-594) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell
ldklkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitifme
yrldyrtaadttglqpilnqftpanisrqahill

SCOPe Domain Coordinates for d5neua2:

Click to download the PDB-style file with coordinates for d5neua2.
(The format of our PDB-style files is described here.)

Timeline for d5neua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5neua1