SCOP 1.71: Domain d1vrta1: 1vrt A:430-539

Lineage for d1vrta1 (1vrt A:430-539)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (85 PDB entries)

8. Domain d1vrta1: 1vrt A:430-539 [33574]
   Other proteins in same PDB: d1vrta2, d1vrtb_
   complexed with cya, mg, nev

Details for d1vrta1

PDB Entry: 1vrt, 2.2 Å

PDB Description: high resolution structures of hiv-1 rt from four rt-inhibitor complexes

SCOP Domain Sequences for d1vrta1:

Sequence, based on SEQRES records:

>d1vrta1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah

Sequence, based on observed residues (ATOM records):

>d1vrta1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglevnivtdsq
yalgiiqaqpdqseselvnqiieqlikkekvylawvpah

Timeline for d1vrta1:

• d1vrta1 first appeared (with stable ids) in SCOP 1.55
  
• d1vrta1 appears in SCOP 1.69
  
• d1vrta1 appears in SCOP 1.73
  
• d1vrta1 appears in the current release, SCOPe 2.08