Lineage for d5ntna_ (5ntn A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2013274Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2013275Protein automated matches [191142] (6 species)
    not a true protein
  7. 2013288Species Human (Homo sapiens) [TaxId:9606] [189274] (54 PDB entries)
  8. 2013310Domain d5ntna_: 5ntn A: [335737]
    automated match to d3l0la_
    complexed with 98h

Details for d5ntna_

PDB Entry: 5ntn (more details), 1.9 Å

PDB Description: structural states of rorgt: x-ray elucidation of molecular mechanisms and binding interactions for natural and synthetic compounds
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5ntna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ntna_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
ynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyk
elfst

SCOPe Domain Coordinates for d5ntna_:

Click to download the PDB-style file with coordinates for d5ntna_.
(The format of our PDB-style files is described here.)

Timeline for d5ntna_: