SCOPe 2.05: Domain d1ekeb_: 1eke B:

Lineage for d1ekeb_ (1eke B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein Class II ribonuclease H (RNase HII) [53103] (5 species)

7. Species Methanococcus jannaschii [TaxId:2190] [53104] (1 PDB entry)

8. Domain d1ekeb_: 1eke B: [33573]
   complexed with mes

Details for d1ekeb_

PDB Entry: 1eke, 2 Å

PDB Description: crystal structure of class ii ribonuclease h (rnase hii) with mes ligand

PDB Compounds: (B:) ribonuclease hii

SCOPe Domain Sequences for d1ekeb_:

Sequence; same for both SEQRES and ATOM records:

>d1ekeb_ c.55.3.1 (B:) Class II ribonuclease H (RNase HII) {Methanococcus jannaschii [TaxId: 2190]}
miiigideagrgpvlgpmvvcafaiekereeelkklgvkdskeltknkraylkkllenlg
yvekrileaeeinqlmnsinlndieinafskvaknlieklnirddeieiyidacstntkk
fedsfkdkiediikernlnikiiaehkadakypvvsaasiiakaerdeiidyykkiygdi
gsgypsdpktikfledyfkkhkklpdiarthwktckrildkskqt

Timeline for d1ekeb_:

• d1ekeb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ekeb_ appears in SCOPe 2.04
  
• d1ekeb_ appears in SCOPe 2.06
  
• d1ekeb_ appears in the current release, SCOPe 2.08