Lineage for d1ekeb_ (1eke B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25212Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 25213Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 25214Protein Class II ribonuclease H (RNase HII) [53103] (1 species)
  7. 25215Species Archaea (Methanococcus jannaschii) [TaxId:2190] [53104] (1 PDB entry)
  8. 25217Domain d1ekeb_: 1eke B: [33573]

Details for d1ekeb_

PDB Entry: 1eke (more details), 2 Å

PDB Description: crystal structure of class ii ribonuclease h (rnase hii) with mes ligand

SCOP Domain Sequences for d1ekeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ekeb_ c.55.3.1 (B:) Class II ribonuclease H (RNase HII) {Archaea (Methanococcus jannaschii)}
miiigideagrgpvlgpmvvcafaiekereeelkklgvkdskeltknkraylkkllenlg
yvekrileaeeinqlmnsinlndieinafskvaknlieklnirddeieiyidacstntkk
fedsfkdkiediikernlnikiiaehkadakypvvsaasiiakaerdeiidyykkiygdi
gsgypsdpktikfledyfkkhkklpdiarthwktckrildkskqt

SCOP Domain Coordinates for d1ekeb_:

Click to download the PDB-style file with coordinates for d1ekeb_.
(The format of our PDB-style files is described here.)

Timeline for d1ekeb_: