Lineage for d5m30d1 (5m30 D:1-118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745477Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)
  8. 2745610Domain d5m30d1: 5m30 D:1-118 [335721]
    Other proteins in same PDB: d5m30d2, d5m30e2, d5m30f2
    automated match to d4ldeb_

Details for d5m30d1

PDB Entry: 5m30 (more details), 2.6 Å

PDB Description: structure of tssk from t6ss eaec in complex with nanobody nb18
PDB Compounds: (D:) Anti-vesicular stomatitis virus N VHH

SCOPe Domain Sequences for d5m30d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m30d1 b.1.1.1 (D:1-118) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvesggglvqaggtlklscaasgsisgivvmawyrqapgkqrelvasitsggttnya
dsvkgrftiskdnaentlylrmnslkpedtavyyckaffrrdyvgydywgqgtqvtvs

SCOPe Domain Coordinates for d5m30d1:

Click to download the PDB-style file with coordinates for d5m30d1.
(The format of our PDB-style files is described here.)

Timeline for d5m30d1: