SCOP 1.69: Domain d1ekea_: 1eke A:

Lineage for d1ekea_ (1eke A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein Class II ribonuclease H (RNase HII) [53103] (4 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [53104] (1 PDB entry)

8. Domain d1ekea_: 1eke A: [33572]

Details for d1ekea_

PDB Entry: 1eke, 2 Å

PDB Description: crystal structure of class ii ribonuclease h (rnase hii) with mes ligand

SCOP Domain Sequences for d1ekea_:

Sequence, based on SEQRES records:

>d1ekea_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Archaeon Methanococcus jannaschii}
miiigideagrgpvlgpmvvcafaiekereeelkklgvkdskeltknkraylkkllenlg
yvekrileaeeinqlmnsinlndieinafskvaknlieklnirddeieiyidacstntkk
fedsfkdkiediikernlnikiiaehkadakypvvsaasiiakaerdeiidyykkiygdi
gsgypsdpktikfledyfkkhkklpdiarthwktckrildkskqt

Sequence, based on observed residues (ATOM records):

>d1ekea_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Archaeon Methanococcus jannaschii}
miiigideagrgpvlgpmvvcafaiekereeelkklgvkeltknkraylkkllenlgyve
krileaeeinqlmnsinlndieinafskvaknlieklnirddeieiyidacstntkkfed
sfkdkiediikernlnikiiaehkadakypvvsaasiiakaerdeiidyykkiygdigsg
ypsdpktikfledyfkkhkklpdiarthwktckrildkskqt

Timeline for d1ekea_:

• d1ekea_ first appeared (with stable ids) in SCOP 1.55
  
• d1ekea_ appears in SCOP 1.67
  
• d1ekea_ appears in SCOP 1.71
  
• d1ekea_ appears in the current release, SCOPe 2.08