| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Rhodospirillum rubrum [TaxId:269796] [335612] (2 PDB entries) |
| Domain d5l8fi1: 5l8f I:7-96 [335719] Other proteins in same PDB: d5l8fb2, d5l8fg2, d5l8fi2 automated match to d1zpyg_ complexed with mg, pge; mutant |
PDB Entry: 5l8f (more details), 2.25 Å
SCOPe Domain Sequences for d5l8fi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l8fi1 a.25.1.0 (I:7-96) automated matches {Rhodospirillum rubrum [TaxId: 269796]}
stheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrdeakeaa
amtlewlrrndakwaehlrtylftegpita
Timeline for d5l8fi1: