Lineage for d1ril__ (1ril -)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245987Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 246267Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
    consists of one domain of this fold
  5. 246268Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 246353Protein RNase H (RNase HI) [53100] (3 species)
  7. 246384Species Thermus thermophilus [TaxId:274] [53102] (1 PDB entry)
  8. 246385Domain d1ril__: 1ril - [33571]

Details for d1ril__

PDB Entry: 1ril (more details), 2.8 Å

PDB Description: crystal structure of ribonuclease h from thermus thermophilus hb8 refined at 2.8 angstroms resolution

SCOP Domain Sequences for d1ril__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ril__ c.55.3.1 (-) RNase H (RNase HI) {Thermus thermophilus}
rkrvalftdgaclgnpgpggwaallrfhahekllsggeacttnnrmelkaaieglkalke
pcevdlytdshylkkaftegwlegwrkrgwrtaegkpvknrdlwealllamaphrvrfhf
vkghtghpenervdrearrqaqsqakt

SCOP Domain Coordinates for d1ril__:

Click to download the PDB-style file with coordinates for d1ril__.
(The format of our PDB-style files is described here.)

Timeline for d1ril__: