SCOPe 2.07: Domain d1rcha_: 1rch A:

Lineage for d1rcha_ (1rch A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein RNase H (RNase HI) [53100] (4 species)

7. Species Escherichia coli [TaxId:562] [53101] (33 PDB entries)
   Uniprot P0A7Y4

8. Domain d1rcha_: 1rch A: [33570]

Details for d1rcha_

PDB Entry: 1rch

PDB Description: solution nmr structure of ribonuclease hi from escherichia coli, 8 structures

PDB Compounds: (A:) ribonuclease hi

SCOPe Domain Sequences for d1rcha_:

Sequence; same for both SEQRES and ATOM records:

>d1rcha_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
ehcevilstdsqyvrqgitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwew
vkghaghpenercdelaraaamnptledtgyqvev

Timeline for d1rcha_:

• d1rcha_ first appeared (with stable ids) in SCOP 1.55, called d1rch__
  
• d1rcha_ appears in SCOPe 2.06
  
• d1rcha_ appears in the current release, SCOPe 2.08