Lineage for d5o2ub_ (5o2u B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355831Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)
  8. 2356254Domain d5o2ub_: 5o2u B: [335691]
    Other proteins in same PDB: d5o2ua_, d5o2uc_
    automated match to d4y5vd_

Details for d5o2ub_

PDB Entry: 5o2u (more details), 2.76 Å

PDB Description: llama vhh in complex with p24
PDB Compounds: (B:) vhh 59h10

SCOPe Domain Sequences for d5o2ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o2ub_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasgsisrfnamgwwrqapgkerefvarivkgfdpvlad
svkgrftisidsaentlalqmnrlkpedtavyycfaaldtaywgqgtqvtvssaa

SCOPe Domain Coordinates for d5o2ub_:

Click to download the PDB-style file with coordinates for d5o2ub_.
(The format of our PDB-style files is described here.)

Timeline for d5o2ub_: