SCOP 1.73: Domain d1rdda_: 1rdd A:

Lineage for d1rdda_ (1rdd A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (12 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (4 proteins)

6. Protein RNase H (RNase HI) [53100] (3 species)

7. Species Escherichia coli [TaxId:562] [53101] (30 PDB entries)

8. Domain d1rdda_: 1rdd A: [33569]
   complexed with mg

Details for d1rdda_

PDB Entry: 1rdd, 2.8 Å

PDB Description: crystal structure of escherichia coli rnase hi in complex with mg2+ at 2.8 angstroms resolution: proof for a single mg2+ site

PDB Compounds: (A:) Ribonuclease H

SCOP Domain Sequences for d1rdda_:

Sequence; same for both SEQRES and ATOM records:

>d1rdda_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
ehcevilstdsqyvrqgitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwew
vkghaghpenercdelaraaamnptledtgyqvev

Timeline for d1rdda_:

• d1rdda_ first appeared (with stable ids) in SCOP 1.55, called d1rdd__
  
• d1rdda_ was called d1rdd__ in SCOP 1.71
  
• d1rdda_ appears in SCOP 1.75
  
• d1rdda_ appears in the current release, SCOPe 2.08