SCOPe 2.08: Domain d5loga1: 5log A:1-220

Lineage for d5loga1 (5log A:1-220)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (87 species)
   not a true protein

7. Species Myxococcus xanthus [TaxId:34] [334565] (2 PDB entries)

8. Domain d5loga1: 5log A:1-220 [335677]
   Other proteins in same PDB: d5loga2, d5logb2
   automated match to d3tr6a_
   complexed with cl, ldp, mg, sah

Details for d5loga1

PDB Entry: 5log, 2.01 Å

PDB Description: crystal structure of safc from myxococcus xanthus bound to sam

PDB Compounds: (A:) Putative O-Methyltransferase

SCOPe Domain Sequences for d5loga1:

Sequence; same for both SEQRES and ATOM records:

>d5loga1 c.66.1.0 (A:1-220) automated matches {Myxococcus xanthus [TaxId: 34]}
mihhveltqsvlqyirdssvrdndilrdlreetsklplrtmqippeqgqllsllvrliga
rktlevgvftgystlctalalpadgrviacdlseewvsiarrywqragvadrievrlgda
hhslealvgsehrgtfdlafidadkesydfyyehalrlvrpggliildntlwsgkvadps
vvgdpetdslrrinaklltdervdlsmlpiadgltlarkr

Timeline for d5loga1:

• d5loga1 first appeared in SCOPe 2.06
  
• d5loga1 appears in SCOPe 2.07