Lineage for d5ntib_ (5nti B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2729960Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2729961Protein automated matches [191142] (5 species)
    not a true protein
  7. 2729974Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries)
  8. 2730108Domain d5ntib_: 5nti B: [335676]
    automated match to d3l0la_
    complexed with c3s

Details for d5ntib_

PDB Entry: 5nti (more details), 2.4 Å

PDB Description: structural states of rorgt: x-ray elucidation of molecular mechanisms and binding interactions for natural and synthetic compounds
PDB Compounds: (B:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5ntib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ntib_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
ynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyk
elfs

SCOPe Domain Coordinates for d5ntib_:

Click to download the PDB-style file with coordinates for d5ntib_.
(The format of our PDB-style files is described here.)

Timeline for d5ntib_: