SCOPe 2.08: Domain d5net1_: 5net 1:

Lineage for d5net1_ (5net 1:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (27 species)
   not a true protein

7. Species Foot-and-mouth disease virus [TaxId:12110] [188180] (9 PDB entries)

8. Domain d5net1_: 5net 1: [335673]
   Other proteins in same PDB: d5neta1, d5neta2
   automated match to d1qqp1_
   complexed with ca, man, nag

Details for d5net1_

PDB Entry: 5net, 8.6 Å

PDB Description: localised reconstruction of integrin alpha v beta 6 bound to foot and mouth disease virus o1 manisa - pose a.

PDB Compounds: (1:) O1 Manisa VP1

SCOPe Domain Sequences for d5net1_:

Sequence; same for both SEQRES and ATOM records:

>d5net1_ b.121.4.1 (1:) automated matches {Foot-and-mouth disease virus [TaxId: 12110]}
ttsagesadpvtatvenyggetqvqrrqhtdvsfildrfvkvtpkdqinvldlmqtpaht
lvgallrtatyyfadlevavkhegnltwvpngapeaaldnttnptayhkapltrlalpyt
aphrvlatvyngnskygdgtvanvrgdlqvlaqkaaralptsfnygaikatrvtellyrm
kraetycprpllaihpdqarhkqkivap

Timeline for d5net1_:

• d5net1_ first appeared in SCOPe 2.06
  
• d5net1_ appears in SCOPe 2.07